<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08818
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MRHVFPADAQRLQQYPMIENRTGPQTIEFLTKRVVALGAVQVGQFLVDCETYMSVPQLDFMFEFQLLYQLVRDYWHRWPLLGRLKIPFVI |
| Length | 90 |
| Position | Head |
| Organism | Trachymyrmex septentrionalis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | 0.044 |
| Instability index | 50.32 |
| Isoelectric point | 7.93 |
| Molecular weight | 10745.51 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08818
No repeats found
No repeats found
|