<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08808
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MSIIIFQQCLSILTKDEGLGNSGTGASGGLTVDKDEGRAEIEQATMRFIDLARQMEAFFLQKRFLLSALKPEMLVKEEINELKLELARKEELIKRHNDKIAVWQNMLSDLQGWAQSPAQGPAPSGLPNGNQSGQNQQATGGSGNASMQQQQQILQHQQQLQQQLQQQQQQQQHPQLQQQLQQQMQHPLQSQVQQGSGGPPTSGLQGVGVPVNQQGMFMTQGGVGGRATGFPVGGMGSSALQGPLAYLEKTTSNIGMPERRS |
| Length | 261 |
| Position | Head |
| Organism | Trachymyrmex septentrionalis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.646 |
| Instability index | 71.90 |
| Isoelectric point | 6.43 |
| Molecular weight | 28407.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08808
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.09| 18| 18| 148| 165| 1
---------------------------------------------------------------------------
148- 165 (36.50/12.20) QQQQQILQHQQQLQQQLQ
168- 185 (37.58/12.74) QQQQQHPQLQQQLQQQMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.87| 13| 18| 203| 220| 2
---------------------------------------------------------------------------
203- 215 (24.26/18.47) GLQGVGVPVNQQG
224- 236 (25.62/ 7.51) GGRATGFPVGGMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.52| 10| 55| 131| 141| 5
---------------------------------------------------------------------------
131- 141 (15.55/10.01) QSgQNQQATGG
189- 198 (19.97/ 8.28) QS.QVQQGSGG
---------------------------------------------------------------------------
|