<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08798
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MLLNVKYCFFQQCLSILTKDEGLGNSGTGASGGLTVDKDEGRAEIEQATMRFIDLARQMEAFFLQKRFLLSALKPEMLVKEEINELKLELARKEELIKRHNDKIAVWQNMLSDLQGWAQSPAQGPAPSGLPNGNQSGQNQQATSGSGNAAMQQQQQILQHQQQLQQQLQQQQQQQQQHPQLQQQLQQQMQHPLQPQVQQGSGGPPTSGLQGVGVPVNQQGMFMAQGGVGGRATGFPVGGMGSSALQGPLAYLEKTTSNIGMPERRS |
Length | 266 |
Position | Head |
Organism | Trachymyrmex cornetzi |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.649 |
Instability index | 69.48 |
Isoelectric point | 6.91 |
Molecular weight | 29084.49 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08798
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.49| 14| 15| 159| 173| 1
---------------------------------------------------------------------------
159- 173 (25.71/10.51) QHqQQLQQQLQQQQQ
177- 190 (29.78/ 9.18) QH.PQLQQQLQQQMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.45| 13| 18| 112| 129| 3
---------------------------------------------------------------------------
112- 129 (18.75/20.89) SDlqgwaQSPAQGPAPSG
133- 145 (23.71/11.11) GN.....QSGQNQQATSG
---------------------------------------------------------------------------
|