<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08791
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPLRDKRLQQYPMIENRTGPQTIEFLTKRIVALGAVQVGQFLVDCETYMSVPQLGFMFLLRLLYQLVRDYWHRWPLLGRLKMPFVI |
Length | 86 |
Position | Head |
Organism | Trachymyrmex cornetzi |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
Aromaticity | 0.13 |
Grand average of hydropathy | 0.094 |
Instability index | 69.84 |
Isoelectric point | 9.89 |
Molecular weight | 10285.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08791
No repeats found
No repeats found
|