Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MTPPMERIQILETIEKDIVVCLQSAGQACMELSKEKSSLKQAESQTHQFLKTLGQLESKLSEQINYLTQVSTGMYIYLTISLPYLFQYMFLINVFHRPTTRRFRICKSKGTANGVAQIGARAK |
Length | 123 |
Position | Head |
Organism | Atta colombica |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Myrmicinae> Atta. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.165 |
Instability index | 45.19 |
Isoelectric point | 9.41 |
Molecular weight | 14008.24 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08763 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.40| 20| 26| 22| 41| 1 --------------------------------------------------------------------------- 22- 41 (33.12/22.36) LQSAGQACMELSKEKSSLKQ 50- 69 (32.28/21.64) LKTLGQLESKLSEQINYLTQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RRFRICK 2) VAQIGARAK | 101 115 | 107 123 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab