<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08749
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMMGDQFRSKVEQYSPKSSPRGARSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNLMAYYGLEHSYSKFSGKKLKEQLSSFLPNLPGIIDRPGHQDNSSLRSVIEKPPIGGKELLPLTSVQLAGFRLHPGPLPEQYRYINQAPQRKHKNKHKKHKHKPGEVLSGQETATTDVGGSDTHEKKHKKQKRHDEEKEARKKRKKEKKRKKQKHSPEHTGSLTPSQHSNS |
| Length | 242 |
| Position | Head |
| Organism | Atta colombica |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Atta.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.208 |
| Instability index | 54.10 |
| Isoelectric point | 10.04 |
| Molecular weight | 27178.53 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08749
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.48| 14| 19| 195| 208| 1
---------------------------------------------------------------------------
164- 177 (26.93/ 9.74) HKNKHKKHKHKPGE
195- 208 (27.70/10.17) HEKKHKKQKRHDEE
217- 229 (23.85/ 8.01) KEKKRKKQK.HSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.47| 16| 19| 88| 105| 2
---------------------------------------------------------------------------
99- 120 (12.62/ 9.80) LPNlPGIidrpGHQDnSSLRSV
121- 137 (21.86/ 8.07) IEK.PPI...gGKEL.LPLTSV
---------------------------------------------------------------------------
|