<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08725
| Description |
Kinase-like protein |
| Sequence | MFPGRRPPFHPADRGLGPNVGYQSKVRVIDRYKVIGFISSGTYGRVYKAVGRHGQVGEFAIKKFKPDKEGEQIQYTGISQSAVREMALCSELSHPNIIKLIEIILEDKCIFMVFEYAEHDLLQIIHHHTQPTRHPIPPSTVKSIMFQLLNGCQYLHANWVLHRDLKPANIMVTSGGEVKIGDLGLARLFNKPLHSLFSGDKVVVTIWYRAPELLLGSRHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPAKEKWPHLVNMPEYSQLSTLSASTHPKSGSNLEKWYYSTINSHSATSNPSSNASLGAEGYKLLSGLLEYDPERRLTAQQALQHPFFSTGDKVSSNCFEGVKMEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSRPVKRLKE |
| Length | 414 |
| Position | Kinase |
| Organism | Phialocephala scopiformis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Mollisiaceae> Phialocephala.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.404 |
| Instability index | 38.00 |
| Isoelectric point | 9.26 |
| Molecular weight | 46653.04 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08725
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.21| 15| 33| 332| 347| 2
---------------------------------------------------------------------------
332- 347 (24.68/18.10) GYKLLS....GL.LEYdPERR
362- 381 (20.53/ 9.86) GDKVSSncfeGVkMEY.PHRR
---------------------------------------------------------------------------
|