Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MYELFMTAFINDVDFDRARSLLSGYCWSEPSTRFYRVIHYDGPNPPKPITKTSNIRGIPPQPDPFMYGLPGAEPLQPQVGPYIDPDWRTLSDILKKQSYIVTGRWELSRKADFGGESPAPAPAPAPPPPQTQSRPLNARQGALFWAEIPDPASAAGGQSLILQRNKIEIWNQLNLPAVMADNGFRPKAETVEETHDIYHRDDPMLEFNLVRHYKLPSPAPSAPETTGPLPDPGQLEKTDPAGKWILWAKVHVLSDDKAPEKIKAARDTLARVRDELRGTGIEFRVLDRRVHDTQLAVRKGPATQTLGRTQNLSGPR |
Length | 316 |
Position | Head |
Organism | Valsa mali |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Valsaceae> Valsa. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.630 |
Instability index | 57.69 |
Isoelectric point | 7.83 |
Molecular weight | 35319.62 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08717 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.19| 16| 86| 62| 90| 3 --------------------------------------------------------------------------- 62- 86 (18.58/21.55) PDPfmyG.LPGAEPlqpqVGPYIdpD 230- 246 (27.61/ 6.27) PDP...GqLEKTDP....AGKWI..L --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.65| 21| 96| 184| 218| 4 --------------------------------------------------------------------------- 25- 45 (44.91/15.71) YCWSEPSTRFYRVIHYDGPNP 198- 218 (41.74/13.76) YHRDDPMLEFNLVRHYKLPSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RFYRVIHYD 2) WILWAKVH | 33 244 | 41 251 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab