<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08717
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYELFMTAFINDVDFDRARSLLSGYCWSEPSTRFYRVIHYDGPNPPKPITKTSNIRGIPPQPDPFMYGLPGAEPLQPQVGPYIDPDWRTLSDILKKQSYIVTGRWELSRKADFGGESPAPAPAPAPPPPQTQSRPLNARQGALFWAEIPDPASAAGGQSLILQRNKIEIWNQLNLPAVMADNGFRPKAETVEETHDIYHRDDPMLEFNLVRHYKLPSPAPSAPETTGPLPDPGQLEKTDPAGKWILWAKVHVLSDDKAPEKIKAARDTLARVRDELRGTGIEFRVLDRRVHDTQLAVRKGPATQTLGRTQNLSGPR |
| Length | 316 |
| Position | Head |
| Organism | Valsa mali |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Diaporthales> Valsaceae> Valsa.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.630 |
| Instability index | 57.69 |
| Isoelectric point | 7.83 |
| Molecular weight | 35319.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
RuleBase:RU364150
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08717
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.19| 16| 86| 62| 90| 3
---------------------------------------------------------------------------
62- 86 (18.58/21.55) PDPfmyG.LPGAEPlqpqVGPYIdpD
230- 246 (27.61/ 6.27) PDP...GqLEKTDP....AGKWI..L
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.65| 21| 96| 184| 218| 4
---------------------------------------------------------------------------
25- 45 (44.91/15.71) YCWSEPSTRFYRVIHYDGPNP
198- 218 (41.74/13.76) YHRDDPMLEFNLVRHYKLPSP
---------------------------------------------------------------------------
|