Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSTLFGGNMAAGHTDGHHEKGPLNLSPEDVRALEATRNRLLQLSNTLGSFKNEIYMSNPLPNPQSLQSSARILNQNMTYLLDILQQHSATFQRVVVYPSPNFPGRTQENVLMQLLRKKLEPQVETLVETGRDVALAAGIDPNTSFASNEKSQQERDRVRQVRRDEELLKYGRDVDEDDDDDDSDDEDDDGENDVNEPIGIGDAWADSRAWCQTRLGEFVRDDFNDSYTAEERALGIENPGGAGPGQMGSLPGEIPERMLWYAARGDRELPPAVELEAQRIVRLQGQRGRQQASGR |
Length | 295 |
Position | Head |
Organism | Valsa mali |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Valsaceae> Valsa. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.842 |
Instability index | 45.64 |
Isoelectric point | 4.61 |
Molecular weight | 32960.84 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08709 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 95.06| 29| 38| 124| 156| 1 --------------------------------------------------------------------------- 124- 156 (43.98/33.25) ETLVETGRDValaaGIDPNTSFASNEKSQQERD 165- 193 (51.07/29.98) EELLKYGRDV....DEDDDDDDSDDEDDDGEND --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 101.07| 35| 38| 31| 67| 2 --------------------------------------------------------------------------- 22- 62 (48.65/40.65) PLNLSpedvRALEATRNRLLQ.LSNTLGSFKNEIYMsnPLPN 63- 101 (52.42/36.82) PQSLQ.ssaRILNQNMTYLLDiLQQHSATFQRVVVY..PSPN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GEIPERMLWYAAR 2) QRIVRLQG | 252 278 | 264 285 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab