Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSLNLLALANLVESITKYTPQASQAADLAAADRELGRGLRQLEVHQNNHQQLEALKAASSALDAQIRDTLRTLWTTRKDITSTVTTVFPDGPHYDVNYEELLSYARRISKMTMPPPSIIASYGNVNGHGNGVTAGEDSAVSTGDAVNTPTTTAAPPTPVAGGASTPNPNAMTNGAGTPAPQSQSQSQGQPGTQTTATSGATALPAEWTQFLDPLTGHVFVPWAQDEKVRVGALASIQHLLEQGIDPRSYDPAEEEARRQREEEERRGQEEKEAKEHEEVAKKMREEQARIARERQQERERALEEAQRRGSTGGGPSPVAGPSEPQKRQFQFMGGDLDDDDDD |
Length | 342 |
Position | Middle |
Organism | Valsa mali |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Valsaceae> Valsa. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.820 |
Instability index | 54.32 |
Isoelectric point | 4.92 |
Molecular weight | 37027.11 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08705 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 77.53| 18| 31| 253| 270| 1 --------------------------------------------------------------------------- 253- 270 (31.22/14.89) EEEARRQREEEERRGQEE 277- 294 (27.71/12.59) EEVAKKMREEQARIARER 295- 309 (18.61/ 6.61) QQERERALEEAQRRG... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 112.59| 33| 37| 112| 147| 2 --------------------------------------------------------------------------- 112- 144 (60.90/34.88) TMPPPSII...ASYGNVNG..HGNGVTAGEDSAVSTGD 152- 189 (51.70/22.68) TAAPPTPVaggASTPNPNAmtNGAGTPAPQSQSQSQGQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEQARIARERQQERERALEEAQRRGS 2) GGPSPVAGPSEPQKRQFQFMGGDLDDDDDD | 285 313 | 310 342 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab