Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSQAPPPSVSAGNNKNNSSNPPEPKYGGYTRFEIELEFVQSLANPYYLNHLAAQKLLQQPAFVEYLSYLQYWGRPPYLKYLTYPGPTLKHLELLQQERFRRDIISPDFVNALVQEGTKAAVEWHKEKDV |
Length | 131 |
Position | Middle |
Organism | Valsa mali var. pyri |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Valsaceae> Valsa. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.630 |
Instability index | 58.72 |
Isoelectric point | 6.83 |
Molecular weight | 15043.79 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08688 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 77.76| 16| 28| 38| 53| 1 --------------------------------------------------------------------------- 38- 53 (28.07/14.55) L....EFVQSLANPYYLNHL 68- 83 (29.99/15.93) L....SYLQYWGRPPYLKYL 95- 114 (19.69/ 8.53) LlqqeRFRRDIISPDFVNAL --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) PKYGGYTRFEIE 2) PYLKYLTY | 26 78 | 37 85 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab