<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08673
| Description |
Uncharacterized protein (Fragment) |
| Sequence | RYSILGFLSSGTYGRVYKARGDDEGELVAIKKFKPDKEGEVVTYTGISQSACREIMINREISHENVTALREVMLEEKSIYLVFEYAEHDFLQIIHHHSSTRTQLPLGVLKSLLWQLFNGVSYLHDNWIIHRDLKPANILVNEKGQVKIGDLGLARLYQEPLQSLYTSDKIVVTVWYRSPELLLGARHYTPAIDMWSMGCIYGELLGLRPMFKGEEAKMELGAKKGGVPFQRDQLTRVLEVLGTVDAKQWPGVVQLPEWTNLSRLDRYQDCLSQWFNGRLPRGAPPSLAYDLMRQLLIYDPTKRITARAALCHDWWAQEPKPHVKCVLLSSRGLCRLGVATSATTSRSPSH |
| Length | 350 |
| Position | Kinase |
| Organism | Rhodotorula graminis (strain WP1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.262 |
| Instability index | 35.78 |
| Isoelectric point | 8.76 |
| Molecular weight | 39838.46 |
| Publications | PubMed=26441909
|
Function
| Annotated function |
|
| GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP08673
No repeats found
|