<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08671
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MTHQNHQTNGASLEDCHTNFFALADSDAQPLVILASYSQQNSHVVLLTHKMSSYSASEATRSHRPIEVILNSPGRNVDRNAFARLVSPGRGNNFLITYILTAALGTIPILYCDCDIM |
| Length | 117 |
| Position | Middle |
| Organism | Papilio machaon (Old World swallowtail butterfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.085 |
| Instability index | 48.33 |
| Isoelectric point | 6.26 |
| Molecular weight | 12860.36 |
| Publications | PubMed=26354079
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08671
No repeats found
No repeats found
|