<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08658
| Description |
Cyclin-C |
| Sequence | MAGNFWQSSHHQQWILDKQDLVRDRQHDLNILTEEEYQKIFNFFASIIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTCVFLASKVEEFGVISNSRLITTCQTVIKNKFSYAYGQQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLLFVQDIGPDEQLLTYAWRIVNDSLRTDVSLLFPPYQIAIGAMHIACVMLGKENLKPWFAELNVDMDKIQEIVRSIINLYEMWKSYDEKKEIQGLLGKMPKPKPAPQR |
| Length | 268 |
| Position | Kinase |
| Organism | Papilio machaon (Old World swallowtail butterfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.145 |
| Instability index | 49.13 |
| Isoelectric point | 6.53 |
| Molecular weight | 31426.16 |
| Publications | PubMed=26354079
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08658
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.88| 11| 19| 170| 180| 2
---------------------------------------------------------------------------
170- 180 (20.43/11.82) DEQLLTYAWRI
188- 198 (20.46/11.85) DVSLLFPPYQI
---------------------------------------------------------------------------
|