<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08655
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MDNLKQFNTMGSEDNWRTSNFRQNVVSKIEEVIQRSGMQVARNSSEMENHVYMKAKTREEYMNMVAKLILHVREMSQPKQNQAGGSMQGNNQNQPGPNPQVQTQQGQAPQGPNSQPGLAPDPINALQNLASQGTRNQMMNMGQGQMQQQGVMGPNPGMAGLQAQIGQQGPIVSQGGPQSQAATNLLQTLTQRPQLNMQQMQNKLSMGMVPNQNQMGNNMVSMGGMGNPMGSQLQNQLAGPGMQGQMMPNMSMSNNMQVPMSGSSTMVGQMQCNQVVGGMGGQMAPNAMQGQMSRQMVGGMTNNQMVNMNMLHMQGRVGAKGEVVGGMMGNGYAPAGAPSHNQFLRQSPSPSASSPNMGGPSPVSMGGSVLGGALASPMSSLGAMGACNGVGSPSPSAPAHLPHHPTQQQRGVGVGMGMVASPSSSLNTPAGGGGGVASPGGEEAVYREKVRQLSKYIEPLRRMVQRMVNEGENVEKLTKMKNLLDILSNPNKRMPLETLIKCEVVLEKLDFKRSETVCVILPPAGTGKHEQIFNPLLEVINNCLLSPVSNHTLKRTFGHTLDALNGPEIKNLPPPYKMPKVEEPTMEIPDVLQGEIARLDSRFKVSLETMQLSGGSGAIALVAQLDDVRLPCVPAVHVAVPRDYPAHAPSRLRPRAPRPDAHRAFLAQVDRNMDARCARLPKSCSVGQLLDAWEMSVRQACAPSPVAYTPVPALGL |
Length | 716 |
Position | Tail |
Organism | Papilio machaon (Old World swallowtail butterfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.449 |
Instability index | 55.15 |
Isoelectric point | 9.34 |
Molecular weight | 76541.15 |
Publications | PubMed=26354079
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08655
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 338.48| 54| 55| 105| 158| 2
---------------------------------------------------------------------------
105- 158 (110.30/32.56) QG...Q.APQGP.N..SQPGL.APDP...INA.LQN.LASQ...G..TRNQMM.NMGQ...............GQMQQQGVMGPNPGM
159- 208 (53.66/12.48) AGlqaQiGQQGPiV..SQGG...PQSqaaTNL.LQT.LTQ........RPQ.L.NM.Q................QMQNKLSM....GM
212- 279 (64.08/16.17) QN...Q.M..GN.NmvSMGGM.G.NP...MGSqLQNqLAGP...G..MQGQMMpNMSMsnnmqvpmsgsstmvGQMQCNQVVG...GM
281- 323 (45.64/ 9.63) ................GQ..M.AP......NA.MQG.QMSRqmvGgmTNNQMV.NM.................NMLHMQGRVGAKGEV
345- 395 (64.81/16.43) R....Q.SPSPS.A..SSPNMgGPSP...VSM.GGS.VLGG...A..LASPMS.SLG................AMGACNGVGSPSP..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.74| 21| 25| 562| 586| 3
---------------------------------------------------------------------------
562- 586 (30.42/28.86) DALNGpEIKNLPPPYKmpkVEEPTM
590- 610 (36.32/19.51) DVLQG.EIARLDSRFK...VSLETM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.15| 18| 23| 637| 658| 4
---------------------------------------------------------------------------
637- 658 (28.85/27.03) HvavpRDYPAHAPSRLR...PRAPR
662- 682 (26.30/14.31) H....RAFLAQVDRNMDarcARLPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.38| 16| 24| 448| 467| 5
---------------------------------------------------------------------------
448- 463 (28.28/25.96) EKVRQLSK.......YIEPLRRM
472- 494 (21.10/ 6.82) ENVEKLTKmknlldiLSNPNKRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.94| 19| 24| 518| 537| 6
---------------------------------------------------------------------------
518- 537 (30.95/22.01) CvILPPAGTGKHEQIFNPLL
543- 561 (33.98/19.75) C.LLSPVSNHTLKRTFGHTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.61| 9| 16| 413| 422| 7
---------------------------------------------------------------------------
413- 422 (15.86/ 9.92) GvGMGMVASP
431- 439 (19.75/ 8.29) G.GGGGVASP
---------------------------------------------------------------------------
|