<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08649
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MSAANLAPITATDSLSQALKANIIPNQEYLLQGSVLDSAVEVLLHRLRGLCDNVDAGTETFDDQEVCFSLRDPNQQAAPLMLRVRKALDARDMPFQLRYIGQPDLGDKSRPTVVRSSLDIACSGMLIEFLNELGCRIEFEYSVKGYMFRKGRMKITVSKVFKISQSSMSPEPISQSYLVELSVLAPQGQDAIGEDMRAFADQLRPLVQLDKIDYKRLGHMSVT |
Length | 223 |
Position | Head |
Organism | Papilio machaon (Old World swallowtail butterfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.145 |
Instability index | 56.46 |
Isoelectric point | 5.49 |
Molecular weight | 24832.32 |
Publications | PubMed=26354079
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08649
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.71| 24| 29| 61| 89| 2
---------------------------------------------------------------------------
64- 89 (38.62/35.59) QEVCFSLR.....DPNQQAAPLMlrVRKALD
91- 119 (37.08/18.68) RDMPFQLRyigqpDLGDKSRPTV..VRSSLD
---------------------------------------------------------------------------
|