<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08639
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MVFVVIQPEVFEKTACLNVLTKQEVSPCVEKEEVKVEVERFIDHARQMEAFFLQKRFLLSAMKPELLVKEDNNELKCELQRKDELLRRHYDKVTQWHGLLADLQGHTVYNKCQQQSAPPALQQAASPMPQPCAVQQSVQARYAQAQQMAAAQQAALQQQALQQQQVPRPPHPPAYPAGPQRR |
| Length | 182 |
| Position | Head |
| Organism | Papilio xuthus (Asian swallowtail butterfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.586 |
| Instability index | 80.17 |
| Isoelectric point | 8.28 |
| Molecular weight | 20820.70 |
| Publications | PubMed=26354079
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08639
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.82| 18| 48| 113| 130| 1
---------------------------------------------------------------------------
113- 130 (34.21/13.50) QQQSAPPALQQAASPM.PQ
162- 180 (32.61/12.59) QQQQVPRPPHPPAYPAgPQ
---------------------------------------------------------------------------
|