<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08630

Description Mediator of RNA polymerase II transcription subunit 30
SequenceMAGQGHQFPGNFQGNPGAMRTGYGGGPMGGQIPQMPNQLTGVMAGPMGNAGMVGMGNQMVPPYGAAMQNQMGNMAMGPQGMGVGGGVGPGAAMVQQVVQQQAMQTVPVAAAPPAPPSAPPQQNKDFNTASLCKFGQETVQDIVSRTQDVFQTLKAIQPPNGTQHGENASNDKKAKVQEQLRTIRLLFKRLRLIYEKCNETCQVEGMEYTHMESLIPLKDEADNKTLDERRNTETYRQVLEENNILTEQVVSKNKQLKEVITNLRTIIWEINVMLTMRRS
Length279
PositionHead
OrganismPapilio xuthus (Asian swallowtail butterfly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea> Papilionidae> Papilioninae> Papilio.
Aromaticity0.04
Grand average of hydropathy-0.528
Instability index37.67
Isoelectric point8.40
Molecular weight30385.47
Publications
PubMed=26354079

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08630
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.15|      20|      25|      43|      67|       1
---------------------------------------------------------------------------
   43-   67 (26.45/21.29)	MAgpMGNAGMvGMGNQmVPPyGAAM
   74-   93 (42.69/15.13)	MA..MGPQGM.GVGGG.VGP.GAAM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.29|      30|      43|      95|     125|       2
---------------------------------------------------------------------------
   95-  125 (50.47/33.11)	QQVVQ......QQAMQTVPvAAAPPAPPSAPPQQNKD
  136-  171 (46.83/26.25)	QETVQdivsrtQDVFQTLK.AIQPPNGTQHGENASND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.59|      14|      29|       1|      14|       4
---------------------------------------------------------------------------
    1-   14 (29.19/13.15)	MAGQGHQFPGNFQG
   28-   41 (28.40/12.63)	MGGQIPQMPNQLTG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08630 with Med30 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAGQGHQFPGNFQGNPGAMRTGYGGGPMGGQIPQMPNQLTGVMAGPM
1
47










Molecular Recognition Features






MoRF SequenceStartStop




NANANA