| Description | Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADRLTQLQDTINQQAEHFCNSIGILQQFSTPSKFPGFDRSGSQTPQQQQNQEDYAMLFATLISRCAKDIDTLIESLPSEESSTELQVQSLRRLEAENKEAAEQLEEVVRQGEILLEKIQGALSDIAQCQLDMQNPALILNKDVKPQL |
| Length | 148 |
| Position | Middle |
| Organism | Papilio xuthus (Asian swallowtail butterfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea> Papilionidae> Papilioninae> Papilio. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.532 |
| Instability index | 65.89 |
| Isoelectric point | 4.42 |
| Molecular weight | 16649.47 |
| Publications | PubMed=26354079 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP08619 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) FPGFDR 2) QNQEDYAMLFATLISRCAKDI 3) RRLEA | 35 50 92 | 40 70 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab