Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQRLSMDQLQNMTGLEYILLHVQDPILYVIRKQQRHSPQHVIPLADYYIIAGIVYQAPDLASVLNSRLLSAVHHLQCSFEETMMYSKYHPSKGYWWDFKANKAGSSPFNSAQSAPKEVSTGPKEEPSTLFQRQRVDMLLAELVRQFPLPVIPTTSSQTNGVTVKTENMTDKEKPIESNNVNNITIKQEPIDPVNTEMTNGSMQGHIEIKTEIKQENMKPPPEKKPRNM |
Length | 228 |
Position | Head |
Organism | Papilio xuthus (Asian swallowtail butterfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea> Papilionidae> Papilioninae> Papilio. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.601 |
Instability index | 50.72 |
Isoelectric point | 7.07 |
Molecular weight | 26004.46 |
Publications | PubMed=26354079 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08612 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 136.44| 37| 43| 133| 174| 1 --------------------------------------------------------------------------- 107- 126 (24.98/10.49) ...................PFNSAQSAP.....KEVST...GPKEEP 133- 174 (54.67/47.29) QRVDMLLaelVRQFPLPviPTTSSQTNG.....VTVKTENMTDKEKP 178- 219 (56.79/35.64) NNVNNIT...IKQEPID..PVNTEMTNGsmqghIEIKTEIKQENMKP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GHIEIKTEIKQENMKPPPEKKPRNM 2) YWWDFK | 204 94 | 228 99 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab