<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08608
Description |
Uncharacterized protein |
Sequence | MIHLCRDILKAFITQVLPDICPPANSSTEHIFSPSFLQAVETGTFDAPRWPPSQLAFPVENNFLQNDSPLSHVCARLTMTQYAEHINVVRRLSRQSVNTPNTLGTDGSGSYAPPPHNNPSNQTNVNISSSYSTS |
Length | 134 |
Position | Head |
Organism | Trichobilharzia regenti (Nasal bird schistosome) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Trichobilharzia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.369 |
Instability index | 72.60 |
Isoelectric point | 6.15 |
Molecular weight | 14723.25 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08608
No repeats found
No repeats found
|