<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08603
| Description |
Uncharacterized protein |
| Sequence | MESILWLRRMCLAPQDQTMRPWLQEAISSTRMLESNYTVDGPLTWKAFHQLAGRGSDETCKPQPIPQLRVCGGDQDNLLISPFAVRDWDRLSLFPLSRAKRIAYAVVLPTDSHTLVSPTSNIQNNMISEGTGSNSASNLMRHSLAEFLKELSHTYQSCHLGQHFPYYMPEAGSPETAFIPVFPTPGKRLESNCSLLLCRYLVLNCCLLCSLFSVYVSAVSNVVCFTSYHFSTSSFVKT |
| Length | 238 |
| Position | Middle |
| Organism | Trichobilharzia regenti (Nasal bird schistosome) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Trichobilharzia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.072 |
| Instability index | 54.11 |
| Isoelectric point | 7.56 |
| Molecular weight | 26695.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08603
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.83| 13| 14| 46| 58| 1
---------------------------------------------------------------------------
46- 58 (22.68/16.76) KAFHQLAGRGSDE
63- 75 (25.15/19.33) QPIPQLRVCGGDQ
---------------------------------------------------------------------------
|