<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08602
| Description |
Uncharacterized protein |
| Sequence | LTVSQFIQLIRPTYAKLKLRVTSKCSTTPTPTPTATTMTTSNRMNSKLTLLESYLSTSLLFHAAVLANQSLDVPVLAVMNDQKADDHRINQQNTNDVYANAAFMSVWPICQLTVHVSMLSTCCRQPTGIESSSCSPSSCWWRLKLQLTQNQSGAFTAFFQLLLLPPHALRAMARVLAFDLHSPAQAPVYVRIGLIGMGINSRVTAVANSMGNNNNNQSTNSAQQNLLIFDTGTDLQVGMPGIIVRPPKITLQLLIMRSHSRHQVGLFICCCCFFNSVFHYYNMHNFIISDEAICNN |
| Length | 296 |
| Position | Tail |
| Organism | Trichobilharzia regenti (Nasal bird schistosome) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Trichobilharzia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.081 |
| Instability index | 42.54 |
| Isoelectric point | 9.04 |
| Molecular weight | 32788.57 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.66| 15| 25| 225| 239| 3
---------------------------------------------------------------------------
225- 239 (26.61/19.01) NLLIFDTGTDLQVGM
252- 266 (27.05/19.43) QLLIMRSHSRHQVGL
---------------------------------------------------------------------------
|