Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | LSTLALCASELSEIRKVLESERFSNEHTLVLTPMVLNPEQDANLAKITEERLSLFNHDTVPQYLRTKLDPKVESECSSQVTRASGIPSEQLNKLINLTNRAIDCSLKEVNLLKQDLEVDFSDRQNKITPNLDDLTTFINIISGKKGLNISSL |
Length | 152 |
Position | Head |
Organism | Trichobilharzia regenti (Nasal bird schistosome) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Trichobilharzia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.318 |
Instability index | 40.47 |
Isoelectric point | 5.09 |
Molecular weight | 17038.18 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08586 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) TFINIIS 2) YLRTKL | 136 63 | 142 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab