<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08575
Description |
Uncharacterized protein |
Sequence | LPLQPSAVLSFFRLLLIPAQVLRALLCLFDSDLHSGGASQQQQQQQQQAPAVRVRVALTSVTSLPDSGVDQAAIVVQPPLLSLQLLVSSLARRQAVGGTFPPTQSPSFTTGVIPLTFNWTTNRVSITPTTGVGAKCVLAQRLRDARLDEQTNSHCVETNECALVQLTRIILQHPGLGNLATGPTGRA |
Length | 187 |
Position | Tail |
Organism | Schistocephalus solidus (Tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Diphyllobothriidea> Diphyllobothriidae> Schistocephalus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | 0.127 |
Instability index | 46.99 |
Isoelectric point | 9.37 |
Molecular weight | 19934.69 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08575
No repeats found
No repeats found
|