<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08568
Description |
Uncharacterized protein |
Sequence | LTELQDAVNLQAQNLCNAVGVIQQVAQPSFFPELNWTARASRPEYQALFPDQSQQGDIAFNFASAIAATAKQIEILINSLPGEEVSLELQDEANRRHIRDYRAESAKLVQLITHGFQHRLSAVRRLLSRIAETQLLARTLENECLLTDWHGFCACFRPTKTSMDAESLPPPTAPTEVDTGTLEGAYFLWTSHLYFCLAVVFLSRLVGSLLPVVLPFLVNNLPSARARRSAYSRTEKEIRDLRRQMAGLNMVDNFAAYSKLERKLRSLERQQVSSEQSQFGTSLVTGVVAKTLRLALNGLMIAWLVFNSPTTDLAKDQLAKASAQTVYGLPVGFFIFLAHYVPNRILTVFWIALCEAASSASISWFTTRLTSLGTSSSSSPVN |
Length | 382 |
Position | Middle |
Organism | Schistocephalus solidus (Tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Diphyllobothriidea> Diphyllobothriidae> Schistocephalus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.014 |
Instability index | 55.07 |
Isoelectric point | 8.24 |
Molecular weight | 42417.00 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
Receptor for GET3/TRC40-mediated insertion of tail-anchored
(TA) proteins into the ER membrane.
ECO:0000256 RuleBase:RU366036
ECO:0000256 ARBA:ARBA00003304
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | tail-anchored membrane protein insertion into ER membrane GO:0071816 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08568
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.55| 21| 40| 131| 153| 1
---------------------------------------------------------------------------
116- 151 (25.74/18.25) FQ......hrlsavrrllsriAETQLLARTLENECLLtdWHG
152- 191 (28.81/14.42) FCacfrptktsmdaeslppptAPTEVDTGTLEGAYFL..WTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.99| 15| 25| 230| 244| 2
---------------------------------------------------------------------------
230- 244 (26.97/18.96) AYSRTEKEIRDLRRQ
256- 270 (26.02/18.06) AYSKLERKLRSLERQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.80| 26| 29| 281| 306| 3
---------------------------------------------------------------------------
281- 306 (42.22/34.28) TSLVTGVVAKTLRLALNGLMIAWLVF
311- 336 (43.57/35.62) TDLAKDQLAKASAQTVYGLPVGFFIF
---------------------------------------------------------------------------
|