<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08553
Description |
Uncharacterized protein |
Sequence | LNSLKSRLRDYLKTITENFELILARAKVTVENSDVIVRLNPYTQAEQDNFEMNVRSCNIVSACENITRLVSEIKQLLILGDFCWLEKVTKMGAEERERRRAELDAVAIKLADELAADLFTLDDKLGTTVNHAALASTSSSSATDDLRPFAPKPEPF |
Length | 156 |
Position | Head |
Organism | Schistocephalus solidus (Tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Diphyllobothriidea> Diphyllobothriidae> Schistocephalus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.228 |
Instability index | 48.62 |
Isoelectric point | 5.02 |
Molecular weight | 17502.73 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08553
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.38| 15| 28| 7| 34| 1
---------------------------------------------------------------------------
7- 21 (26.03/32.96) RLRDYLKTITENFEL
38- 52 (28.36/ 9.86) RLNPYTQAEQDNFEM
---------------------------------------------------------------------------
|