<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08535
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSGSEKSKVNLTSHVSLFPAPPWQLINKLFSTETPPRPPTPPGSTAYRMFGNFYNSEDAILRSLESQGVRRVYPQTYNRKRELRKINFSILANYLDLLDIITRDPSSCKRTEKLDHLAILFINMHHLVNEYRQHQARDLLREILKYQVINYFVHLFYFIVI |
| Length | 161 |
| Position | Middle |
| Organism | Schistosoma rodhaini |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.358 |
| Instability index | 57.93 |
| Isoelectric point | 9.64 |
| Molecular weight | 18970.65 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08535
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.72| 17| 21| 48| 65| 1
---------------------------------------------------------------------------
48- 65 (25.55/20.58) RMFGNFYNSEDAiLRSLE
71- 87 (30.18/19.40) RVYPQTYNRKRE.LRKIN
---------------------------------------------------------------------------
|