<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08531
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSSRVSLKQKLIGQLEDADSILRDILSAASKKKSVTLLPLIELLLEKDQQLKETYKEIEVYNEIQKKIDLLKADCSKSDKQIQSCQLHLKKTEFILSTALYYSRQKLDSMTTAVKNPIDMEELVRFSHRISATHGVIAPDNWTQGDPRRPYPNKEEIRRGYLGHIDDAGNFRQSLWDALSETAAAAASIVVSSTPSASSNSCPNSLSNANIGTSQTPVYHSNQTQPTSLSLVTCSPNMILPGVNMVSSPMSFSQSGGSSTWTGPNMNLITGNPTSSELAGSQTSASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPPLKQGSGQMQASQVTSFRPSGVLPRPPNSGNRQAFPSSPNSSGSQHMQYPHSDTHPSFMPSSKTSRPHSKRAHRKHTDTECTEMSSNSSSDSSSGEE |
Length | 412 |
Position | Middle |
Organism | Schistosoma rodhaini |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.640 |
Instability index | 60.85 |
Isoelectric point | 8.69 |
Molecular weight | 44749.48 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08531
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.27| 20| 22| 350| 369| 1
---------------------------------------------------------------------------
312- 346 (25.57/ 8.19) L.PPPPLK.QGSGQMQasqvtsfrpsgvlprPPNSGN
350- 369 (40.51/16.81) F.PSSPNS.SGSQHMQ...............YPHSDT
373- 394 (25.18/ 7.96) FmPSSKTSrPHSKRAH...............RKHTDT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.26| 21| 21| 187| 207| 2
---------------------------------------------------------------------------
187- 207 (37.35/21.29) ASIVVSS....TPSASSN.SCPNSLS
209- 230 (33.76/18.50) ANIGTSQ....TPVYHSNqTQPTSLS
232- 253 (21.15/ 8.71) ...VTCSpnmiLPGVNMV.SSPMSFS
---------------------------------------------------------------------------
|