<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08523
| Description |
Uncharacterized protein |
| Sequence | MNTVVLIAVRGIKNFWKHKNDEDKESILLHHSILLTHPTFFSLLQICLPDCDFIIDSLYEQIEYFLLNSRHLIDHVPENLHTRQIIQNCLKYRLILIGQKFHIIQLDIDMTIRWITLLTQLISYGIIEPESNSILFYIVYDMLQLLIHTLTSRTGIEGKHYQMIAKKLRRELLEHPSNT |
| Length | 179 |
| Position | Kinase |
| Organism | Schistosoma mattheei |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.077 |
| Instability index | 50.21 |
| Isoelectric point | 6.58 |
| Molecular weight | 21203.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08523
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.18| 17| 36| 22| 38| 1
---------------------------------------------------------------------------
22- 38 (30.14/13.96) EDKESILLHHSILLTH.P
60- 77 (27.04/12.01) EQIEYFLLNSRHLIDHvP
---------------------------------------------------------------------------
|