<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08518

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMSSRVSLKQKLIGQLEDADSILRDILSAASKKKSSVTLLPLIELLLEKDQQLKETYKEIEVYNEIQKKIDLLKADCSKSDKQIQSCQLHLKKTEVILSTALYYSRQKLDSMTTAVKNPIDMEELVRFSHRISATHGVIAPDNWTQGDPRRPYPNKEEIRRGYLGHIDDAGNFRQSLWDALLDTAAAAASIVGSSTPSVSSSSGPNSLGNTNIVASQTPVYHSNQTQPTSLSLVTCSPNMILPGVNMVSSPMSFSQSGGSSTWTGPNMNLITGNPTGSELAGSQISASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPPLKPGSGQMQTSQATSFRPSGVLPRPSNSGNRQAFPSSPNSSGSQHMQYPHSDTHPGFMPNSKTSRPHSKRAHRKHTDTECTEMSSNSSSDSSSGEE
Length413
PositionMiddle
OrganismSchistosoma mattheei
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
Aromaticity0.04
Grand average of hydropathy-0.617
Instability index56.62
Isoelectric point8.75
Molecular weight44665.43
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364141

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08518
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.62|      18|      20|     345|     362|       1
---------------------------------------------------------------------------
  325-  342 (21.29/ 6.86)	MQTSQATSFRP..SGvlPR.P
  345-  362 (33.00/14.83)	SGNRQAFPSSPNSSG..SQ.H
  368-  384 (25.33/ 9.61)	SDTHPGFM..PNSKT..SRpH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.05|      18|      21|     190|     207|       2
---------------------------------------------------------------------------
  190-  207 (31.85/15.19)	IVGSSTPSV.SSSSGPNSL
  212-  230 (27.20/11.95)	IVASQTPVYhSNQTQPTSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      81.91|      20|      22|     275|     294|       3
---------------------------------------------------------------------------
  243-  269 (21.97/ 8.73)	.GVNMVSSPMSFSQSggsstwtgPNMNL
  275-  294 (32.67/16.64)	TGSELAGSQISASRP........PSTSL
  299-  318 (27.27/12.65)	TGTNIMDQH...SRN.....ttlPPPPL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08518 with Med4 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GSSTPSVSSSSGPNSLGNTNIVASQTPVYHSNQTQPT
2) MVSSPMSFSQSGGSSTWTGPNMNLITGNPTGSELAGSQISASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPPLKPGSGQMQTSQATSFRPSGVLPRPSNSGNRQAFPSSPNSSGSQHMQYPHSDTHPGFMPNSKTSRPHSKRAHRKHTDTECTEMSSNSSSDSSSGEE
192
246
228
413










Molecular Recognition Features






MoRF SequenceStartStop




1) KRAHRKH
386
392