<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08515
Description |
Uncharacterized protein |
Sequence | MDSDAKVLSDLETQLDNIFMVLSSTSLHDSDISESQHGLNDKHMASLLDACRQMDSWFIKKRLALSTYCQEYALKEEIDALNAECIRKEKLAQELKGRIEDYSKSIQVIIDQVHTPYCG |
Length | 119 |
Position | Head |
Organism | Schistosoma mattheei |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.407 |
Instability index | 43.58 |
Isoelectric point | 4.85 |
Molecular weight | 13570.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08515
No repeats found
No repeats found
|