<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08499
| Description |
Uncharacterized protein |
| Sequence | RVYSIISELSQCSPIKIIAHWDTFNSATETSVRLCFYCTDYDAYRSWLGVTITPNGLVVLYADPPRTYRLGMDLNRLRDVLNNQVLYTQMNYIDILAIKILGWVRLGNNPFSALANPEEIGDGPVIVKMFASPSAKHLICLRASAVMDIRMFVSRCSPCDYQFTTDHKDIFSNQDFREVFLSHMYGKSLVSKVEALMTLLS |
| Length | 201 |
| Position | Head |
| Organism | Schistosoma mattheei |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.084 |
| Instability index | 34.37 |
| Isoelectric point | 7.05 |
| Molecular weight | 22866.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08499
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.91| 15| 142| 10| 24| 1
---------------------------------------------------------------------------
10- 24 (30.89/14.93) SQCSPIK...IIAHWDTF
154- 171 (26.02/11.88) SRCSPCDyqfTTDHKDIF
---------------------------------------------------------------------------
|