<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08492
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSSRVSLKQKLIGQLEDADSILRDILSAASKKKSSVTLLPLIELLLEKDQQLKETYKEIEVYNEIQKKIDLLKADCSKSDKQIQSCQLHLKKTEVILSTALYYSRQKLDSMTTAVKNPIDMEELVRFSHRISATHGVIAPDNWTQGDPRRPYPNKEEIRRGYLGHIDDAGNFRQSLWDALLDTAAAAASIVGSSTPSVSSSSGPNSLGNANIGASQTPVYHSNQTQPTSLSLVTCSPNMILPGVNMVSSPMSFTQSGGSSTWTGPNMNLITGNPTSSELSGPQTSASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPPLKPGSGQMQASQATSFRPSGVLPRPSNSGNRQAFPSSPNSSGSQHMQYPHSDTHPGFMPNSKTSRPHSKRAHRKHTDTECTEMSSNSSSDSSSGEE |
| Length | 413 |
| Position | Middle |
| Organism | Schistosoma margrebowiei |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.637 |
| Instability index | 57.22 |
| Isoelectric point | 8.75 |
| Molecular weight | 44621.33 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08492
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.74| 22| 22| 306| 327| 1
---------------------------------------------------------------------------
255- 281 (25.79/ 7.75) QSGGSSTWTGPNMnlitgNPTSSELSG
306- 327 (41.85/16.41) QHSRNTTLPPPPL.....KPGSGQMQA
332- 350 (29.09/ 9.53) SFRPSGVLPRP........SNSGNRQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.80| 20| 20| 188| 207| 2
---------------------------------------------------------------------------
188- 207 (34.69/17.95) ASIVGSSTPSV.SSSSGPNSL
210- 230 (32.11/16.07) ANIGASQTPVYhSNQTQPTSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.72| 16| 22| 351| 370| 3
---------------------------------------------------------------------------
363- 381 (27.28/12.62) MQYPHSDThpgFM..PNSKTS
388- 408 (18.44/ 8.94) AHRKHTDTectEMssNSSSDS
---------------------------------------------------------------------------
|