<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08485
| Description |
Uncharacterized protein |
| Sequence | MQSNQRSTSSNQPNFPRKRNTHVQGLKSRLRSNINSILSNYEMILSRSKIDPNEVTKGLGPYAQCAQDTFEFSVRAANIVHACENITRLVSEIKQFLILGDFRWLARVNSLNQEKLILRKLDLDRVSNRLRDKLVAELHNLEQETSPDYPINTFQKKTTS |
| Length | 160 |
| Position | Head |
| Organism | Schistosoma margrebowiei |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.656 |
| Instability index | 56.80 |
| Isoelectric point | 9.82 |
| Molecular weight | 18458.75 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08485
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.00| 17| 17| 105| 121| 1
---------------------------------------------------------------------------
105- 121 (26.92/19.33) LARVNSLNQEKLI..LRKL
123- 141 (23.08/15.63) LDRVSNRLRDKLVaeLHNL
---------------------------------------------------------------------------
|