<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08476
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MNPSPAFSAANGTGSNLQAGNTASATWINKLKIVGRGQNWAVAPCEPFYLMGTEPPAPDAALTGAKNLIEHYGLENAYQKFCGKRLREELNAFLPHLSGNIDVPASVDESGLMSLIERPPIRGKELRPFAPSQLDHAFRLHPGPLPQEYASLFAAAPSKHIHRSVQDQQQLSGSNATGTRVPATAVPGLSSSGSFHRRRRRHEVHRGALASGSDSSSSIGVPGVGGGNVSASPASFFTGPPTAYPQLGTVHTTTSLPSKPMLSQSHTLSSSLSITTSAPSTNITMPNQSSNASDNNPVTQMVNHSKLVDHPPGLIPVSAPHSHLLGSSISTSSTSSEPPPPPLLAPIHHHPNQKLPHSIQNTSSTLNPLYNSNTSDASLTPSKSVPPAPPVLHSIHPPSINPINSSVPSQPPSSHQFYHHHRHQQQQQQLSSHLHHHQHPLSSMHHHHPITSSHSYPSSLSQNSSRSMSPIPMETNSSSPQSPDIYKIRRLDMTDEERRKKKRREKKRRKDKE |
| Length | 513 |
| Position | Head |
| Organism | Schistosoma margrebowiei |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.686 |
| Instability index | 72.55 |
| Isoelectric point | 9.82 |
| Molecular weight | 55347.05 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08476
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
6| 215.96| 31| 33| 158| 188| 1
---------------------------------------------------------------------------
158- 186 (38.73/11.85) .............SKHIHRSVQDQQQLSGSNATGTRVPAT.AV
187- 221 (32.00/ 8.50) PG........lssSGSFHRRRRRHEVHRGALASGSDSSSSiGV
245- 283 (35.12/10.06) PQlgtvhtttslpSKPM...LSQSHTLSSSLSITTSAPST.NI
316- 340 (34.57/ 9.78) P...........vSAP.H.....SHLLGSSISTSSTSSEP.PP
389- 411 (31.94/ 8.47) P..................PVLHSIHPPSINPINSSVPSQ.P.
443- 471 (43.61/14.28) .............SMHHHHPITSSHSYPSSLSQNSSRSMS.PI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.07| 9| 15| 413| 423| 3
---------------------------------------------------------------------------
413- 423 (17.05/14.23) SSHqfYHHHRH
431- 439 (21.02/10.09) SSH..LHHHQH
---------------------------------------------------------------------------
|