Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MNPSPAFSAANGTGSNLQAGNTASATWINKLKIVGRGQNWAVAPCEPFYLMGTEPPAPDAALTGAKNLIEHYGLENAYQKFCGKRLREELNAFLPHLSGNIDVPASVDESGLMSLIERPPIRGKELRPFAPSQLDHAFRLHPGPLPQEYASLFAAAPSKHIHRSVQDQQQLSGSNATGTRVPATAVPGLSSSGSFHRRRRRHEVHRGALASGSDSSSSIGVPGVGGGNVSASPASFFTGPPTAYPQLGTVHTTTSLPSKPMLSQSHTLSSSLSITTSAPSTNITMPNQSSNASDNNPVTQMVNHSKLVDHPPGLIPVSAPHSHLLGSSISTSSTSSEPPPPPLLAPIHHHPNQKLPHSIQNTSSTLNPLYNSNTSDASLTPSKSVPPAPPVLHSIHPPSINPINSSVPSQPPSSHQFYHHHRHQQQQQQLSSHLHHHQHPLSSMHHHHPITSSHSYPSSLSQNSSRSMSPIPMETNSSSPQSPDIYKIRRLDMTDEERRKKKRREKKRRKDKE |
Length | 513 |
Position | Head |
Organism | Schistosoma margrebowiei |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.686 |
Instability index | 72.55 |
Isoelectric point | 9.82 |
Molecular weight | 55347.05 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08476 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 6| 215.96| 31| 33| 158| 188| 1 --------------------------------------------------------------------------- 158- 186 (38.73/11.85) .............SKHIHRSVQDQQQLSGSNATGTRVPAT.AV 187- 221 (32.00/ 8.50) PG........lssSGSFHRRRRRHEVHRGALASGSDSSSSiGV 245- 283 (35.12/10.06) PQlgtvhtttslpSKPM...LSQSHTLSSSLSITTSAPST.NI 316- 340 (34.57/ 9.78) P...........vSAP.H.....SHLLGSSISTSSTSSEP.PP 389- 411 (31.94/ 8.47) P..................PVLHSIHPPSINPINSSVPSQ.P. 443- 471 (43.61/14.28) .............SMHHHHPITSSHSYPSSLSQNSSRSMS.PI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.07| 9| 15| 413| 423| 3 --------------------------------------------------------------------------- 413- 423 (17.05/14.23) SSHqfYHHHRH 431- 439 (21.02/10.09) SSH..LHHHQH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FYHHHR 2) PQSPDIYKIRRLDMTDEERRKK 3) REKKRR | 417 480 504 | 422 501 509 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab