<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08469
| Description |
Uncharacterized protein |
| Sequence | MQALVQSVSSTQISNSSVHLISKLTWNQLFVVLNAFSTDNEVSQLIQRLIDTFWTNETAKDNQKLEHGVLWSRLIKNGKIDFPYDLSAYGRLQPLSHHLMRTMSVHVRML |
| Length | 110 |
| Position | Tail |
| Organism | Schistosoma curassoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.143 |
| Instability index | 20.71 |
| Isoelectric point | 9.22 |
| Molecular weight | 12668.40 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08469
No repeats found
No repeats found
|