<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08455

Description Uncharacterized protein
SequenceMEDVRTKRGAGIASDHHLLVAKMKLKLKKHRTMGRTISRKFNTAFLQDTDKLNKFKIVLSNKFQAFHGLLNGEGTTMESKWEGIKEAITSTCHEVLGHKKHHHKEWITVDTLDKFQERRNKKAAINTRRTRAEKAKTQAEYTDVNKQVKRSIRTDKRKYVEDLATTAEKAAREGNMRQLYDTTKKLSGNRRKPERPVKSKEGEIERLVRLLDILDRHEYHLVREPNPMESLYNRIFNDDSIHVDTAIIVITLCEWAVSPYRIGIYRSIIVACLLEQLKNTFYGDNSINSNNCTAHLPPFNGEQSLIENNLMRNLVCLFSELIDREVFDHDNYVRYFIARGVFDTSLHPLALIDNTMQNKMNTNPLSINNNNTINQSVNTPTNITRTTTGGTNMSTASITCHSQTTAQHSVKSEFSEDMDRYSMDNPDSVRSESGIMNLMSLQSNNNQPINHQSFSSSSSLSNNQGITNSNRHLHYLVQFPIPQDESYAHEQNQRFQLLYGSVRSRDRARYPIRKLIRDICKLFTKKIYLIDVFHGELGRRKRSKDREREKDVNNNNNTANNNNVNSNNLGTTLGLGSLVGQSTTSGTGTSNNGSNVIGNGSSHRSVSNNNSNDETRSIDEVHEDITKRFINLSFYDMEYVLSQCTPVFVKMLSGSNFHSTVNASNDDNNNNNNSNITSINTNSPLSSSSSSTNTQNTTTTTTTTVSSSNSFVTTVSNNNNNPLSMTTSNTQSHIYMPVPSSIFLFFELIETSLNITSLILTIIDTLERLKILFENRTHFMTLYMSSLCLRSVGILQRYQNILFTMGDISCRLFPTLIEQVRQVKEPTQCGPLERCILIYLNDLFTSNIVIKTRFTPIYGKAHQKVNALLRRIDPNDGIGQFDPDYANDLITITSMDNVTSFRAYADDLRNKPDSRYSFVCKAIIWICQAKTIEHVNYLCGLCAELTSQCSELTSEWLGAFYAILAPHSYVHGYSPLINTIDPSQIWIYDNLSSLIGTLLSRYCFTISDFLRLVICPAMAQGLDNVTQPVSVQLKSIISLACHILHCLFTAESTVSSLQTTSNVLTPNPDMNLSNTTTTTTNTTDNLSNSPTSPPFRISEPLLLTAALQKVTSEFLVDVLKMLIVHSDKASVDNNNNNTGFCSQEDIIDETDNATGNDDNNEDSDANQDDDGGDEEHDDENDDNDGGGGGGGGGGTLNTQDNLDDLTDIDSEGDNSILRNTTRKRTRTILQPHQKDNYNKSKRFKSRHNRRFTNRKSISKIHYIIQRFLEHDILPTTMELRTLPLNALTQLVLREICTISWVRERFYQMTSNQLIRENVLIDKNFTQSQARRLLHIIYWPYDITWIDIASTNEGLSGAMCHILHNLNIWTLKCTQIEFQLLYSQISFSQQTEVLDDNDPVWLFPALIAKLPKSLKAQIVKVTSEFLTIFANVKLIGGFGWLNRTLLVGTLVLLGSIMPERLV
Length1461
PositionKinase
OrganismSchistosoma curassoni
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
Aromaticity0.07
Grand average of hydropathy-0.462
Instability index43.65
Isoelectric point6.83
Molecular weight165280.15
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08455
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.23|      16|      17|     409|     425|       1
---------------------------------------------------------------------------
  409-  425 (24.16/18.50)	SVKSEfSEDMDRYSMDN
  428-  443 (27.07/15.54)	SVRSE.SGIMNLMSLQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.76|      15|      17|    1157|    1172|       2
---------------------------------------------------------------------------
 1157- 1171 (28.47/10.26)	DDNNEDSDANQDDDG
 1177- 1191 (28.29/11.11)	DDENDDNDGGGGGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.75|      16|      17|     281|     296|       4
---------------------------------------------------------------------------
  281-  296 (32.35/15.86)	FYGDNSINSNNCTAHL
  299-  314 (26.39/11.48)	FNGEQSLIENNLMRNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     185.72|      41|     309|     357|     397|       5
---------------------------------------------------------------------------
  357-  397 (74.51/33.60)	QNKMNTNPLSINNNNTI.NQSVNTPTNITRTTTGGTNMS.TAS
  669-  710 (65.79/28.81)	NNNNNSNITSINTNSPLsSSSSSTNTQNTTTTTTTTVSS.SNS
 1061- 1089 (45.42/17.64)	SNVLTPNP.DMNLSN.............TTTTTTNTTDNlSNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      74.22|      16|     305|    1100|    1115|       6
---------------------------------------------------------------------------
  945-  957 (18.81/12.40)	...LTSQCSELTSEWL
 1100- 1115 (27.53/22.35)	PLLLTAALQKVTSEFL
 1410- 1425 (27.89/22.76)	PKSLKAQIVKVTSEFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.84|      16|     418|     715|     734|       7
---------------------------------------------------------------------------
  715-  734 (26.08/20.23)	VSNNNNNplsmTTSNTQSHI
 1131- 1146 (32.76/15.38)	VDNNNNN....TGFCSQEDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     231.62|      73|     418|      52|     145|       8
---------------------------------------------------------------------------
   64-  145 (108.56/105.10)	QAFHgLLNGEGTTMESKWEGIKEAITSTChevlghkKHHHKEWITVDTLDKFQERRnKKAAINTRRTRAEKAKTQAEYTDVN
  493-  565 (123.06/71.41)	QRFQ.LLYGSVRSRDRARYPIRKLIRDIC.......KLFTKKIYLIDVFHGELGRR.KRSKDREREKDVNNNNNTANNNNVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.91|      16|      17|     872|     888|       9
---------------------------------------------------------------------------
  872-  888 (27.17/21.32)	IDPNDGIGQFDPdYAND
  892-  907 (28.74/17.18)	ITSMDNVTSFRA.YADD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.24|      18|     254|     215|     232|      10
---------------------------------------------------------------------------
  215-  232 (35.05/24.33)	DRHEYHLVREPNPMESLY
  470-  487 (35.19/24.46)	NRHLHYLVQFPIPQDESY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      49.04|      10|      39|     795|     804|      11
---------------------------------------------------------------------------
  766-  774 (15.38/ 7.71)	LER....LK.ILFE
  795-  804 (19.93/12.18)	LQR....YQNILFT
  832-  845 (13.74/ 6.10)	LERciliYLNDLFT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.91|      14|      20|     241|     254|      16
---------------------------------------------------------------------------
  241-  254 (24.46/17.68)	IHVDTAIIVITLCE
  262-  275 (24.45/17.67)	IGIYRSIIVACLLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.13|      14|     727|     643|     668|      18
---------------------------------------------------------------------------
  600-  615 (21.76/16.77)	GSS.HRSVsnNNSNDET
  654-  668 (22.36/ 9.63)	GSNfHSTV..NASNDDN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.40|      13|      22|      26|      41|      20
---------------------------------------------------------------------------
   26-   41 (18.21/19.96)	KLKKHRTMgrtISRKF
   51-   63 (22.19/13.32)	KLNKFKIV...LSNKF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.99|      17|     416|     616|     632|      22
---------------------------------------------------------------------------
  616-  632 (27.44/18.53)	RSIDEVHEDITKRFINL
  635-  651 (30.55/21.51)	YDMEYVLSQCTPVFVKM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08455 with Med12 domain of Kingdom Metazoa
Unable to open file!