<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08439
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSSRVSLKQKLIGQLEDADSILRDILSAASKKKSSVTLLPLIELLLEKDQQLKETYKEIEVYNEIQKKIDLLKADCSKSDKQIQSCQLHLKKTEVILSTALYYSRQKLDSMTTAVKNPIDMEELVRFSHRISATHGVIAPDNWTQGDPRRPYPNKEEIRRGYLGHIDDAGNFRQSLWDALLDTAAAAASIVSSSTPSVSSSSGPNSLGNANIVASQTPVYHSNQTQPTSLSLVTCSPNMILPGVNMVSSPMSFSQSGGSSTWTGPNMNLVTGNPTSSELAGPQIPASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPPLKPGSGQMQASQATSFRPSGVLPRPSNSGNRQAFPSSPNSSGSQHMQYPHSDTYPGFMPNSKTSRPHSKRAHRKNTDTECTEMSSNSSSDSSSGEE |
| Length | 413 |
| Position | Middle |
| Organism | Schistosoma curassoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.607 |
| Instability index | 59.07 |
| Isoelectric point | 8.74 |
| Molecular weight | 44674.47 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08439
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.05| 20| 20| 188| 207| 1
---------------------------------------------------------------------------
188- 207 (34.29/16.90) ASIVSSS....TPSV.SSSSGPNSL
210- 229 (23.62/ 9.44) ANIVASQ....TPVYhSNQTQPTS.
231- 253 (23.13/ 9.10) .SLVTCSpnmiLPGV.NMVSSPMSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 130.33| 33| 35| 314| 348| 2
---------------------------------------------------------------------------
274- 296 (32.55/ 9.81) ......PTSSELAGPQIPASRP......PSTSLAA
314- 348 (54.68/26.61) PPPPLKPGSGQMQASQATSFRPsGVLPrPSNSGNR
352- 376 (43.11/14.76) PSSPNSSGSQHMQYPHSDTY.P.GFMP........
---------------------------------------------------------------------------
|