<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08436
Description |
Uncharacterized protein |
Sequence | LLNFVSNDGTYDREPSFTTVSFVDVDQEGTYASGSQDVASYSPPEDWTPSISPIVVHTSVLSRICADSGTGQRAEWSYLQKFFASIVVLEKIKDQNVGVWRPGQVNINSSVFDFKFYIDQTSLSQVLVKITKNGT |
Length | 135 |
Position | Tail |
Organism | Soboliphyme baturini |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Dioctophymatida> Dioctophymatoidea> Soboliphymatidae> Soboliphyme.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.191 |
Instability index | 30.43 |
Isoelectric point | 4.65 |
Molecular weight | 14966.43 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08436
No repeats found
No repeats found
|