<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08434
| Description |
Uncharacterized protein |
| Sequence | MKECQTALVWNELEAPCFGTQESSKSYLCRSALDLLPCFPSELPTVQCAGASEIIVKELQRLELNIKDRSVAVESHWSFDKCQQSKLGEKVWTQFPYPLSGG |
| Length | 102 |
| Position | Kinase |
| Organism | Soboliphyme baturini |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Dioctophymatida> Dioctophymatoidea> Soboliphymatidae> Soboliphyme.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.258 |
| Instability index | 50.65 |
| Isoelectric point | 5.09 |
| Molecular weight | 11454.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08434
No repeats found
|