<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08433
| Description |
Uncharacterized protein |
| Sequence | MTRNHQVQTTMLPVYFKNVCLSFIPVMDLFIQKLIELPSVCLKFLDTMMNTIGPLFRFHPHPVTMLYTTFRFYEKKLIDSSQVKLKLVYTIHNAFVGVRGESWLLSSDFLQYITQVNDSYDSRIVWLPDMDYFAQLVKRLIDCFATPFQLHASLRKKWWRFSEFPTLQNHILHAICIELMCLPCSPPDIGNSLLNIILKWHPLINRNDIYHWLNCLGLIFSALPVRNFFSYIHQFAHFLSSNILKVSTRRYHQQFVRKT |
| Length | 259 |
| Position | Tail |
| Organism | Soboliphyme baturini |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Dioctophymatida> Dioctophymatoidea> Soboliphymatidae> Soboliphyme.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | 0.125 |
| Instability index | 45.36 |
| Isoelectric point | 9.34 |
| Molecular weight | 30725.83 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08433
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.64| 18| 21| 103| 120| 2
---------------------------------------------------------------------------
103- 120 (32.67/18.32) WLLSSDFL.QYITQVNDSY
126- 144 (30.98/17.08) WLPDMDYFaQLVKRLIDCF
---------------------------------------------------------------------------
|