<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08427
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MHDGNPECARHSTKDRLLDVVDDLDLICRQLTEAITLATEQLQRKKYIEALEDEIRCKDQYIEKIRNCFLESEDVLINAIFQANQKLKSIAQSEYRKVTPDELIRYAHRISVSHSVAATASWSQGDPERPYPRDCEMRAGWLSRXXXXXXXXXXXXXXXXXXXFSMQMALDPMHGGGFDTCDPSGTMAPPRVGGNCWLSPRSVFQGHQVSPRVSGGCMTGASSSSSISVTNASSSPAMARTASCFPPHGPSVTVAMNVSVKTEPSSTDDNVEVLSTDSSSTSSSDSPE |
Length | 288 |
Position | Middle |
Organism | Soboliphyme baturini |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Dioctophymatida> Dioctophymatoidea> Soboliphymatidae> Soboliphyme.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.476 |
Instability index | 57.75 |
Isoelectric point | 5.30 |
Molecular weight | 29379.49 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08427
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.66| 18| 54| 219| 236| 1
---------------------------------------------------------------------------
219- 236 (29.24/15.78) TGASSSSSISVTNASSSP
237- 254 (30.58/16.83) AMARTASCFPPHGPSVTV
276- 287 (20.84/ 9.20) TDSSSTSS......SDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.74| 12| 18| 185| 196| 4
---------------------------------------------------------------------------
185- 196 (25.78/13.72) GTMAPPRVGGNC
206- 217 (24.97/13.11) GHQVSPRVSGGC
---------------------------------------------------------------------------
|