<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08417
| Description |
Uncharacterized protein |
| Sequence | MVEEESQVLRLTNYEQRQYEMQIRTANMTRCAEALIKLVSDLKQFLILNDFEFVNETVEFTNSQCQLIRKELNDKLLTVKEEAAVCLQEAEQEYYNTSLQDRTSFIL |
| Length | 107 |
| Position | Head |
| Organism | Soboliphyme baturini |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Dioctophymatida> Dioctophymatoidea> Soboliphymatidae> Soboliphyme.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.413 |
| Instability index | 36.75 |
| Isoelectric point | 4.52 |
| Molecular weight | 12679.24 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08417
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.62| 23| 75| 2| 25| 1
---------------------------------------------------------------------------
2- 25 (36.53/23.87) VEEESQVLrLTNYEQRQYE..MQIRT
79- 103 (36.10/19.28) VKEEAAVC.LQEAEQEYYNtsLQDRT
---------------------------------------------------------------------------
|