<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08400
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MNFIALLREQTLVRDLGGLLDQVTLLSLQCERALQTERIGSDSSKHCEYIISEVDQRELPLVFQAACEVACMEMNCRRPPHDVRSVLLHDWGVQVSNEMREPRESECMALLQEIGPILEESLRIARSSPLFGSNNIVEGPLTWRFFDRKALKATGGMEDDSGPEAVPNIVVASEKDAVITSPQIIRLWEKMSLEPYDQPKDVLYIGVVPDNLICIEKTKKYLVDLSRMYEQCRFGRHIPFTREVLRDGLLRVPTRYPATNPGECDNFLNQVERHIGDNKSLITRLKVYMQYFENEMARILINNDDVFNREKYRAALAESQMHSMSHISASYQCGGYTISNSDHISPSSAPGNIIVGQPTEASQNASNTSGPSSAGPTSSNTGESLTTDGPIGDGGAQNMNSFSSFMVEQLIADGTIAEDEPGTLPHVIVIYLVNPFLLGAEENPLVARVVTVALMRAFNALLYRLNNKCRPQLQLEMITLQSIFDYCGISADFLKDERGRLNGRLEKSQNERLSSSDSLKSVAFSVYTHSRVVLPDIVRGILPKSMTRFGPASAMVDLLNDLERKEPIYYKIPSKPFILAPPSLVMQRPNCDLMQINTDEAVLFVSYCLIGNDWLAATVTDHQGHSLDNCLINLRLKPDHKRVNMKYKQSTQIRDSLYRLWSYILGTLANGTRNWRLVIGRVGRIGHGEFKYF |
| Length | 693 |
| Position | Middle |
| Organism | Onchocerca flexuosa |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.255 |
| Instability index | 46.46 |
| Isoelectric point | 5.87 |
| Molecular weight | 77862.13 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08400
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 134.15| 39| 39| 137| 175| 2
---------------------------------------------------------------------------
137- 175 (66.06/37.87) VEGPLTWRFFDRKALKATGGMEDDSGPEAVPNIVVASEK
179- 217 (68.09/39.23) ITSPQIIRLWEKMSLEPYDQPKDVLYIGVVPDNLICIEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.52| 16| 17| 356| 371| 3
---------------------------------------------------------------------------
335- 350 (27.50/14.96) GYTISNSDHIS.PSSAP
356- 371 (29.06/16.20) GQPTEASQNAS.NTSGP
375- 390 (22.96/11.36) G.PTSSNTGESlTTDGP
---------------------------------------------------------------------------
|