<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08399
| Description |
Uncharacterized protein |
| Sequence | MAAHPVGVSSFPQPPEYARQYTDANVAKKNVLPPPIIPSEFTVFGEEYNFEEVSIFFYPKRFVFFFFFFLLNLDYFYFS |
| Length | 79 |
| Position | Middle |
| Organism | Onchocerca flexuosa |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
| Aromaticity | 0.27 |
| Grand average of hydropathy | 0.123 |
| Instability index | 60.32 |
| Isoelectric point | 4.84 |
| Molecular weight | 9354.56 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08399
No repeats found
No repeats found
|