<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08396
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MNAQPGGLFGHQHEPERLASAISHIENKALDVKTNIEQLLLMLDLQEEVEWPDMLDKFSSLASAMTQLQFILKKSALPSGFEDFGFFLRTHVLVPHCLSNDIDPNLQQVTSNRIHCWNHDAAPDYLRTKLTPEVETDESHIDNEKNTRTFDQINKQILAMNKHIETLLASMAENARNQAEIQQDIPTYNSQDTQKLVRAIVNGEGVRPSKLIPTESGITGSSVNGPHGTVRPSGTTASPQQRR |
| Length | 243 |
| Position | Head |
| Organism | Onchocerca flexuosa |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.551 |
| Instability index | 55.60 |
| Isoelectric point | 5.54 |
| Molecular weight | 27168.18 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08396
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.47| 20| 25| 185| 209| 2
---------------------------------------------------------------------------
185- 209 (31.67/28.66) IPTYNSqdtqkLVRAIVNG.EG.VRPS
212- 233 (29.81/16.34) IPTESG.....ITGSSVNGpHGtVRPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.49| 10| 16| 96| 105| 3
---------------------------------------------------------------------------
96- 105 (20.53/12.55) HCLSNDIDPN
115- 124 (22.96/14.73) HCWNHDAAPD
---------------------------------------------------------------------------
|