<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08359
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MCCAYSDLAKAALYAQTDLPRHVWYHSRREMEGLVDLSVKSKKNENARHLGVIATDFGARSQEPFNQKIHTLMSGLQELDQMRSQFMDVKVPLELLDVLDQGKNPQLYTKEVLERTLLKNKEVNGKVETYKKFHAALLKELGEEMPEDTMTYRNIRDIMDK |
| Length | 161 |
| Position | Middle |
| Organism | Heligmosomoides polygyrus bakeri (Parasitic nematode) (Heligmosomoides bakeri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Heligmosomatidae> Heligmosomoides.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.623 |
| Instability index | 39.95 |
| Isoelectric point | 6.52 |
| Molecular weight | 18660.25 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08359
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.52| 19| 19| 113| 131| 1
---------------------------------------------------------------------------
93- 111 (21.75/11.19) LE..LLDvlD..QGKNPQLYTKE
113- 131 (29.59/17.37) LERTLLK..N..KEVNGKVETYK
133- 153 (26.18/14.69) FHAALLK..ElgEEMPEDTMTYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.66| 17| 20| 33| 49| 2
---------------------------------------------------------------------------
33- 49 (27.87/18.55) GLV..DLSVKSKKNENAR.H
51- 70 (21.80/13.36) GVIatDFGARSQEPFNQKiH
---------------------------------------------------------------------------
|