<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08358

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMAINGGSLEDCFSNVYALTELNGLKWRCFLTPSNSPRGVPIQSDPILKAYGQCLRDGLLCTWRRKPLQMSSQPEPLPLPSFTNEISKELWLFWYSNDPPEKLSINTSHLDADENGVGSAANGINYEVRVLLFQALHTMIERSMAHDGFVRFGRWFTRPLQLPQMKYLHTLPVFSYIMATNVQFFVHGGNTVCMTVNAQRQPPLLRLSKRHLECGRRVQVVVGPWSLHAVLLPMGTEVGRNQPSAEKQWEEWREFVAPLVRDIDEPEEESLVIAHASLTERFSGPVEDGIPRMVPVEIDGIRMLYPSCYVCVTMEDDAACLKEEPEAPAMTPDELISELISLLENCRTLLTYSFQPQTMVAGISYWSQMPTAIPTCRDTILDLHFDSVFDACPICSCNTSIRARELGLYITPPDVLRMPAHVQQAQIGSWSGFALEQANTCTCGFSAVRHRYLSLCSGLFPEDSREATAIEHSVAPVNGLGEVGLQASSQIWFDSTSSTDVNMLDLLRIMCQQHNMGRMVHQIKHFQPQEVGFDVSSNAEYVLSQVDATELMLIGNSAAEMSRSGFSVFSGNRSRNTNQPILQFFHPWGLQVFGELYAEWRGLLSEIGPILERAMRVVRCMPGTPGNIVEGPLTWRALTNKSLPKAAAPGHDEDISLPEPIPYINVAAEKDAIRAAPHVVRHWEHLSLGPIDQPKDVLYLAVVPDNVDICSLAVKYMEQLSQMYERMRLGRHIAMPTGGESRDGCVRVGSRTQTGKYPTETTTLDFLNLVSRYVDNKAFMTKLRVSSSFSAWSRFFLVRVFQLFTQQMEENVLQLVSERDDIFERATYRETLALDWRAKRAAAAAVALAVEQRMAESTWKLRLISAKSTVFAGSAEQGVTVAAPEPPPAEPPLEPEDIPVDEPGTLPHVIVIYVFNPFTWGTEFRSALFTRVATLAVMRAFNTVCLRLPPNRRPQLQLEIIPMEQVTDLLGCLPDYTNDSGASQYLLFPRDLNSVFQNTVMSVYTQPRVLTADCIKSVQARCMTKFGPGSSLLDSLDEWERGGTNVYYKVPSNAYHLAPPPLLYQKHENGRVIQTCPDEQVLYVTYCVTGSDWLCVAVTDSLGRLNDNCLINLRTRIYKYRQQTQILDAMGRLWTYILGVLSMETRNWRLVIGRLGRIGHGEFKAWTYLLNKTALKRHSARLKEVCTACAQMPGCTGTPSILSACLVSTEPEPYLRMFPGFTFNDAYNSFSSFVFSKKVRSALPDDTNVTHIMVFPTIRSILQLGSADQHAVGEDDWDFSDMDIPICMHEIISSLLNPNASFRNAGNSFFSENTADVSMENQPLATGFYVSTAPAADVPDWFWASCPGAKNRTPVHLKSSLHINVPLVHQGDEFLQGKSATGEKQEKESVHPLDSTRTDEVLRHVLETYNALSWLNVDVVSGERRSCLPIHMQALTRLYHSVTRLIM
Length1446
PositionMiddle
OrganismHeligmosomoides polygyrus bakeri (Parasitic nematode) (Heligmosomoides bakeri)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Trichostrongyloidea> Heligmosomatidae> Heligmosomoides.
Aromaticity0.09
Grand average of hydropathy-0.156
Instability index45.80
Isoelectric point5.75
Molecular weight162152.61
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08358
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     172.53|      50|     313|     914|    1117|       1
---------------------------------------------------------------------------
  857-  906 (89.27/53.81)	TWKLRLISAKSTVFAGSAEQGV..TVAAPEPPPAEPPLEPEDIPV....DEPGTLP
  918-  973 (83.27/245.77)	TWGTEFRSALFTRVATLAVMRAfnTVCLRLPPNRRPQLQLEIIPMeqvtDLLGCLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.68|      14|      80|    1218|    1231|       2
---------------------------------------------------------------------------
 1218- 1231 (28.21/20.31)	PGFTFNDAYNSFSS
 1297- 1310 (27.47/19.56)	PNASFRNAGNSFFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     104.14|      22|      80|     289|     310|       3
---------------------------------------------------------------------------
   36-   53 (24.85/12.55)	.PRGVPIQSDPILKA.....YGQC...
  289-  310 (43.27/27.79)	IPRMVPVEIDGIRML.....YPSCYVC
  368-  394 (36.03/21.80)	MPTAIPTCRDTILDLhfdsvFDACPIC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     121.51|      35|     361|     738|     773|       6
---------------------------------------------------------------------------
  738-  773 (57.31/46.38)	GESRDGCVrVGSRTQTGKYPTETTTLDFLNLVSRYV
 1102- 1136 (64.20/46.90)	GRLNDNCL.INLRTRIYKYRQQTQILDAMGRLWTYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.14|      19|     318|     321|     339|      11
---------------------------------------------------------------------------
  321-  339 (34.63/20.49)	KEEPEAPAMTPDELIS..ELI
  640-  660 (30.51/17.17)	KSLPKAAAPGHDEDISlpEPI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08358 with Med13 domain of Kingdom Metazoa
Unable to open file!