<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08347
Description |
Uncharacterized protein |
Sequence | MFLLSMMMHSITNLDSNRSEASPSPPIHICTVYEIKKLGYASFNVFDYTGVSADFLKDERGRLNGYDQGRLEKSQNERLSSSDSIKTIAFSVYSQSRVVLPEIVRGLLPKSMTRFGPASAMVDLLNDLERKEPIYYK |
Length | 137 |
Position | Middle |
Organism | Gongylonema pulchrum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.309 |
Instability index | 48.89 |
Isoelectric point | 7.83 |
Molecular weight | 15522.59 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08347
No repeats found
No repeats found
|